PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.10040s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family GeBP
Protein Properties Length: 379aa    MW: 41179 Da    PI: 5.2935
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.10040s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF5731382.9e-43144237297
                DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkife 90 
                           +fqrlwseeDei++LqG+idfk +tgksp++d+++fyef+kksisf+vsk+q+++Kir+L+kK+ +k+ k  +g epsf k+hd+k+fe
  Bostr.10040s0010.1.p 144 AFQRLWSEEDEIAVLQGMIDFKGDTGKSPYEDTNGFYEFIKKSISFEVSKNQFMDKIRSLRKKYMGKEGK--NGVEPSFVKAHDKKAFE 230
                           69*******************************************************************9..***************** PP

                DUF573  91 lskkiWg 97 
                           lsk iWg
  Bostr.10040s0010.1.p 231 LSKFIWG 237
                           ******9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.1E-33145237IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MTKKPNHLEE PPTASSSDDD DVETSGSTAE SSSEEGESTK APITTPSVTT AAPSKSTAVA  60
DSDSGSETET DSDSESTTPP NSGSGKTISL NLKKKEDLNP SAALALPAVR SGTKRPASEA  120
AASTKRVKKI TSGGGEEESI KKPAFQRLWS EEDEIAVLQG MIDFKGDTGK SPYEDTNGFY  180
EFIKKSISFE VSKNQFMDKI RSLRKKYMGK EGKNGVEPSF VKAHDKKAFE LSKFIWGPEG  240
IAPDTNGKSN GVSKKSQSKA KNKLDSVKQE LLFVASSPNG KKVEDGDDKD VLVHGVDSTK  300
SDWFDNSFLV RMIAGFGIDE YYVKQLWSLV PVESKKMIEE KLKLLQAKEL EFVLEKNEFL  360
HDVTSVIVEA SKNKPLDK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302389.11e-165hypothetical protein CARUB_v10020457mg
TrEMBLR0GHD81e-165R0GHD8_9BRAS; Uncharacterized protein
STRINGAT1G61730.11e-162(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.11e-133DNA-binding storekeeper protein-related transcriptional regulator